ALKBH8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180473

Catalog No. NBP180473

Description

ALKBH8 Polyclonal specifically detects ALKBH8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ALKBH8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ABH8MGC10235, AlkB homologue 8, alkB, alkylation repair homolog 8 (E. coli), alkylated DNA repair protein alkB homolog 8, EC 1.14.11.-, EC 2.1.1.-, FLJ38204, Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 91801
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: EAW67088
• Gene Symbols: ALKBH8
• Immunogen: Synthetic peptide directed towards the N terminal of human ALKBH8. Peptide sequence MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Canine: 92%; Equine: 85%; Guinea pig: 78%.
• Target Species: Human, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG