Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALKBH8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | ALKBH8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18047320
|
Novus Biologicals
NBP18047320UL |
20 μL | N/A | N/A | N/A | ||||
|
NBP180473
|
Novus Biologicals
NBP180473 |
100 μL | N/A | N/A | N/A | ||||
Description
ALKBH8 Polyclonal specifically detects ALKBH8 in Human samples. It is validated for Western Blot.Specifications
| ALKBH8 | |
| Polyclonal | |
| Rabbit | |
| EAW67088 | |
| 91801 | |
| Synthetic peptide directed towards the N terminal of human ALKBH8. Peptide sequence MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ABH8MGC10235, AlkB homologue 8, alkB, alkylation repair homolog 8 (E. coli), alkylated DNA repair protein alkB homolog 8, EC 1.14.11.-, EC 2.1.1.-, FLJ38204, Probable alpha-ketoglutarate-dependent dioxygenase ABH8, S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8 | |
| ALKBH8 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title