Learn More
Description
Specifications
Specifications
| Antigen | Allergin-1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Allergin-1, Allergy Inhibitory Receptor 1, C17orf60, Chromosome 17 Open Reading Frame 60, Mast Cell Antigen 32, Mast Cell Immunoglobulin-Like Receptor 1, MCA32, MCA-32, Probable Mast Cell Antigen 32 Homolog |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human Allergin-1 (NP_001078892). Peptide sequence KTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQ |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
