Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. alpha 1B-Glycoprotein Antibody, Novus Biologicals™

alpha 1B-Glycoprotein Antibody, Novus Biologicals™
SDP

Catalog No. NBP157969 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157969 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157969 Supplier Novus Biologicals Supplier No. NBP157969
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

alpha 1B-Glycoprotein Polyclonal specifically detects alpha 1B-Glycoprotein in Human samples. It is validated for Western Blot.

Specifications

Antigen A1BG
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P04217
Gene Alias A1B, ABG, alpha-1-B glycoproteinGAB, alpha-1B-glycoprotein, DKFZp686F0970, HYST2477
Gene Symbols A1BG
Host Species Rabbit
Immunogen Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG.
Molecular Weight of Antigen 54 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge vial prior to reconstitution. Reconstitute in 100μL to a final antibody concentration of 1mg/mL.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.