alpha 1B-Glycoprotein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157969

Catalog No. NBP157969

Description

alpha 1B-Glycoprotein Polyclonal specifically detects alpha 1B-Glycoprotein in Human samples. It is validated for Western Blot.

Specifications

• Antigen: A1BG
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: A1B, ABG, alpha-1-B glycoproteinGAB, alpha-1B-glycoprotein, DKFZp686F0970, HYST2477
• Host Species: Rabbit
• Molecular Weight of Antigen: 54 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P04217
• Gene Symbols: A1BG
• Immunogen: Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1
• Reconstitution: Centrifuge vial prior to reconstitution. Reconstitute in 100μL to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG