Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha 1B-Glycoprotein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | A1BG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
alpha 1B-Glycoprotein Polyclonal specifically detects alpha 1B-Glycoprotein in Human samples. It is validated for Western Blot.Specifications
A1BG | |
Polyclonal | |
Purified | |
RUO | |
P04217 | |
1 | |
Synthetic peptides corresponding to A1BG(alpha-1-B glycoprotein) The peptide sequence was selected from the N terminal of A1BG (NP_570602). Peptide sequence ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG. | |
Primary | |
54 kDa |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
A1B, ABG, alpha-1-B glycoproteinGAB, alpha-1B-glycoprotein, DKFZp686F0970, HYST2477 | |
A1BG | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title