Learn More
alpha-2B Adrenergic R/ADRA2B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | alpha-2B Adrenergic R/ADRA2B |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | ADRA2B adrenergic, alpha-2B-, receptor, ADRA2L1adrenergic receptor alpha 2B, ADRA2RL1, ADRARL1, adrenergic, alpha-2B-, receptor, Alpha-2 adrenergic receptor subtype C2, alpha-2-adrenergic receptor-like 1, alpha-2B adrenergic receptor, Alpha-2B adrenoceptor, Alpha-2B adrenoreceptor, alpha-2B-adrenergic receptor, Alpha-2BAR, ALPHA2BAR, G-protein coupled receptor |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTF |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.