Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
alpha-Galactosidase A/GLA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP158018
Description
alpha-Galactosidase A/GLA Polyclonal specifically detects alpha-Galactosidase A/GLA in Human samples. It is validated for Western Blot.Specifications
alpha-Galactosidase A/GLA | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Agalsidase, agalsidase alfa, Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, alpha-D-galactoside galactohydrolase 1, alpha-gal A, alpha-galactosidase A, EC 3.2.1, EC 3.2.1.22, GALA, galactosidase, alpha, melibiase | |
Rabbit | |
Affinity purified | |
RUO | |
2717 | |
Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P06280 | |
GLA | |
Synthetic peptides corresponding to GLA(galactosidase, alpha) The peptide sequence was selected from the N terminal of GLA (NP_000160). Peptide sequence PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Chicken: 92%; Rabbit: 92%; Zebrafish: 92%; Equine: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction