Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ALPPL2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157946 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157946 100 μL
NBP15794620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157946 Supplier Novus Biologicals Supplier No. NBP157946
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ALPPL2 Polyclonal specifically detects ALPPL2 in Human samples. It is validated for Western Blot.

Specifications

Antigen ALPPL2
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P10696
Gene Alias Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase
Gene Symbols ALPG
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALPPL2(alkaline phosphatase, placental-like 2) The peptide sequence was selected from the N terminal of ALPPL2 (NP_112603). Peptide sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Embryonic Stem Cell Markers, Protein Phosphatase, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 251
Test Specificity Expected identity based on immunogen sequence: Mouse: 81%; Rat: 78%.
Reconstitution Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.