Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ALPPL2 Antibody, Novus Biologicals™

ALPPL2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15794620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15794620 20 μL
NBP157946 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15794620 Supplier Novus Biologicals Supplier No. NBP15794620UL

Description

Rabbit Polyclonal Antibody

ALPPL2 Polyclonal specifically detects ALPPL2 in Human samples. It is validated for Western Blot.

Specifications

Antigen ALPPL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 2.5 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P10696
Gene Alias Alkaline phosphatase Nagao isozyme, alkaline phosphatase, placental-like, alkaline phosphatase, placental-like 2, ALP-1, ALPG, ALPPL, EC 3.1.3.1, GCAP, Germ cell alkaline phosphatase, Nagao isozyme, Placental alkaline phosphatase-like, placental-like alkaline phosphatase, PLAP-like, testicular and thymus alkaline phosphatase
Gene Symbols ALPPL2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ALPPL2(alkaline phosphatase, placental-like 2) The peptide sequence was selected from the N terminal of ALPPL2 (NP_112603). Peptide sequence MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT.
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Embryonic Stem Cell Markers, Protein Phosphatase, Signal Transduction, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 251
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.