Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ALX3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ALX3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ALX3 Polyclonal specifically detects ALX3 in Mouse samples. It is validated for Western Blot.Specifications
ALX3 | |
Polyclonal | |
Purified | |
RUO | |
ALX homeobox 3, aristaless-like homeobox 3, homeobox protein aristaless-like 3, MGC138212, MGC141988, Proline-rich transcription factor ALX3 | |
ALX3 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
O70137 | |
257 | |
Synthetic peptide directed towards the N terminal of mouse ALX3 (NP_031467). Peptide sequence MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR. | |
Primary | |
37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title