Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15497520UL
Description
AMD1 Polyclonal specifically detects AMD1 in Human samples. It is validated for Western Blot.Specifications
AMD1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q5VXN4 | |
AMD1 | |
Synthetic peptides corresponding to AMD1(adenosylmethionine decarboxylase 1) The peptide sequence was selected from the N terminal of AMD1. Peptide sequence MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
adenosylmethionine decarboxylase 1, AdoMetDC, AMD, DKFZp313L1234, EC 4.1.1.50, S-adenosylmethionine decarboxylase 1, S-adenosylmethionine decarboxylase proenzyme, SAMDCFLJ26964 | |
Rabbit | |
21 kDa | |
20 μL | |
Stem Cell Markers | |
262 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction