Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | AMD1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15497520
![]() |
Novus Biologicals
NBP15497520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP154975
![]() |
Novus Biologicals
NBP154975 |
100 μL |
Each for $487.50
|
|
|||||
Description
AMD1 Polyclonal specifically detects AMD1 in Human samples. It is validated for Western Blot.Specifications
AMD1 | |
Polyclonal | |
Rabbit | |
Stem Cell Markers | |
adenosylmethionine decarboxylase 1, AdoMetDC, AMD, DKFZp313L1234, EC 4.1.1.50, S-adenosylmethionine decarboxylase 1, S-adenosylmethionine decarboxylase proenzyme, SAMDCFLJ26964 | |
AMD1 | |
IgG | |
21 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q5VXN4 | |
262 | |
Synthetic peptides corresponding to AMD1(adenosylmethionine decarboxylase 1) The peptide sequence was selected from the N terminal of AMD1. Peptide sequence MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title