Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMDHD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15672120UL
Description
AMDHD1 Polyclonal specifically detects AMDHD1 in Human samples. It is validated for Western Blot.Specifications
AMDHD1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96NU7 | |
AMDHD1 | |
Synthetic peptides corresponding to AMDHD1(amidohydrolase domain containing 1) The peptide sequence was selected from the N terminal of AMDHD1. Peptide sequence AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
amidohydrolase domain containing 1, Amidohydrolase domain-containing protein 1, EC 3.5.2.7, MGC35366, probable imidazolonepropionase | |
Rabbit | |
Affinity Purified | |
RUO | |
144193 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction