Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMDHD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | AMDHD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB5672120UL
|
Novus Biologicals
NBP15672120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP156721
|
Novus Biologicals
NBP156721 |
100 μL |
Each for $487.50
|
|
|||||
Description
AMDHD1 Polyclonal specifically detects AMDHD1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| AMDHD1 | |
| Polyclonal | |
| Rabbit | |
| Q96NU7 | |
| 144193 | |
| Synthetic peptides corresponding to AMDHD1(amidohydrolase domain containing 1) The peptide sequence was selected from the N terminal of AMDHD1. Peptide sequence AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| amidohydrolase domain containing 1, Amidohydrolase domain-containing protein 1, EC 3.5.2.7, MGC35366, probable imidazolonepropionase | |
| AMDHD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title