Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMFR/gp78 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15491620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15491620 20 μL
NBP154916 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15491620 Supplier Novus Biologicals Supplier No. NBP15491620UL

Rabbit Polyclonal Antibody

AMFR/gp78 Polyclonal specifically detects AMFR/gp78 in Human samples. It is validated for Western Blot.

Specifications

Antigen AMFR/gp78
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6PGR1
Gene Alias AMF receptor, AMF receptor, isoform 1, AMF receptor, isoform 2, autocrine motility factor receptor, Autocrine motility factor receptor, isoform 2, gp78, RING finger protein 45, RNF45EC 6.3.2.-
Gene Symbols AMFR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to AMFR(autocrine motility factor receptor) The peptide sequence was selected from the C terminal of AMFR. Peptide sequence FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK.
Molecular Weight of Antigen 73 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 267
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.