Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMFR/gp78 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	AMFR/gp78
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15491620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15491620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP154916 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154916	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

AMFR/gp78 Polyclonal specifically detects AMFR/gp78 in Human samples. It is validated for Western Blot.

Specifications

Antigen	AMFR/gp78
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	Q6PGR1
Gene ID (Entrez)	267
Immunogen	Synthetic peptides corresponding to AMFR(autocrine motility factor receptor) The peptide sequence was selected from the C terminal of AMFR. Peptide sequence FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK.
Primary or Secondary	Primary
Molecular Weight of Antigen	73 kDa

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Zinc Finger
Gene Alias	AMF receptor, AMF receptor, isoform 1, AMF receptor, isoform 2, autocrine motility factor receptor, Autocrine motility factor receptor, isoform 2, gp78, RING finger protein 45, RNF45EC 6.3.2.-
Gene Symbols	AMFR
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

AMFR/gp78 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents