Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMGL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | AMGL |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AMGL Polyclonal specifically detects AMGL in Human samples. It is validated for Western Blot.Specifications
AMGL | |
Polyclonal | |
Rabbit | |
Q99218 | |
266 | |
The immunogen for this antibody is AMGL C-terminal region (NP_001134). Peptide Sequence: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
amelogenin, Y isoform, amelogenin, Y-linked, AMGL, AMGY | |
AMELY | |
IgG | |
20 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title