AMIGO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25664825UL

Catalog No. NB394376

Description

AMIGO2 Polyclonal specifically detects AMIGO2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AMIGO2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: adhesion molecule with Ig-like domain 2, ALI1amphoterin induced gene 2, alivin 1, Alivin-1, AMIGO-2, DEGAamphoterin-induced protein 2, differentially expressed in gastric adenocarcinoma, Differentially expressed in gastric adenocarcinomas, transmembrane protein AMIGO2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AMIGO2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQNGKVRLFPSEAVIAEGILKST
• Quantity: 25 μL
• Research Discipline: Growth and Development, Neuronal Cell Markers, Neuroscience
• Gene ID (Entrez): 347902
• Target Species: Human
• Form: Purified

For Research Use Only