Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP169480

AMIGO3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP169480 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP169480 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP169480 Supplier Novus Biologicals Supplier No. NBP169480
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

AMIGO3 Polyclonal specifically detects AMIGO3 in Human samples. It is validated for Western Blot.

Specifications

Antigen AMIGO3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q86WK7
Gene Alias adhesion molecule with Ig-like domain 3, ALI3, Alivin-3, AMIGO-3, amphoterin-induced gene and ORF 3, amphoterin-induced protein 3, KIAA1851, MGC120552
Gene Symbols AMIGO3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to AMIGO3(adhesion molecule with Ig-like domain 3) The peptide sequence was selected from the N terminal of AMIGO3 (NP_942015). Peptide sequence: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 386724
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.