Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aminopeptidase P1/XPNPEP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18061425UL
Description
Aminopeptidase P1/XPNPEP1 Polyclonal specifically detects Aminopeptidase P1/XPNPEP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Aminopeptidase P1/XPNPEP1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9NQW7, Q9NQW7, Q9NQW7, Q9NQW7 | |
| XPNPEP1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC | |
| 25ul | |
| metabolism, Signal Transduction | |
| 7511 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Aminoacylproline aminopeptidase, APP1, cytosolic, Cytosolic aminopeptidase P, EC 3.4.11.9, sAmp, xaa-Pro aminopeptidase 1, XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble, X-prolyl aminopeptidase 1, soluble | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction