Aminopeptidase P1/XPNPEP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB434145	Novus Biologicals NBP18061425UL	25ul
NBP180614	Novus Biologicals NBP180614	0.1 mL

Description

Aminopeptidase P1/XPNPEP1 Polyclonal specifically detects Aminopeptidase P1/XPNPEP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Aminopeptidase P1/XPNPEP1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q9NQW7, Q9NQW7, Q9NQW7, Q9NQW7
• Gene ID (Entrez): 7511
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: metabolism, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Aminoacylproline aminopeptidase, APP1, cytosolic, Cytosolic aminopeptidase P, EC 3.4.11.9, sAmp, xaa-Pro aminopeptidase 1, XPNPEPLX-prolyl aminopeptidase (aminopeptidase P)-like, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble, X-prolyl aminopeptidase 1, soluble
• Gene Symbols: XPNPEP1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only