AMPD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21429025UL

Catalog No. NB437975

Description

AMPD3 Polyclonal specifically detects AMPD3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AMPD3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q01432
• Gene Symbols: AMPD3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DALSLFTVPEDCPIGQKEAKERELQKELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATS
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: adenosine monophosphate deaminase (isoform E), adenosine monophosphate deaminase 3, AMP aminohydrolase, AMP deaminase 3, AMP deaminase isoform E, EC 3.5.4.6, Erythrocyte AMP deaminase, erythrocyte type AMP deaminase, erythrocyte-specific AMP deaminase, myoadenylate deaminase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 272
• Target Species: Human
• Isotype: IgG

For Research Use Only