Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMPK alpha 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25830225UL
Description
AMPK alpha 1 Polyclonal specifically detects AMPK alpha 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
AMPK alpha 1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
AMP -activate kinase alpha 1 subunit, AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK, AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain, AMPK subunit alpha-1, AMPK1, AMPKa1, EC 2.7.11, EC 2.7.11.1, MGC33776, MGC57364, protein kinase, AMP-activated, alpha 1 catalytic subunit | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
PRKAA1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA | |
25 μL | |
Apoptosis, Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control | |
5562 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction