Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AMPK alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | AMPK alpha 1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AMPK alpha 1 Polyclonal specifically detects AMPK alpha 1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| AMPK alpha 1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control | |
| AMP -activate kinase alpha 1 subunit, AMP-activated protein kinase, catalytic, alpha-1,5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK, AMPK alpha 1,5'-AMP-activated protein kinase, catalytic alpha-1 chain, AMPK subunit alpha-1, AMPK1, AMPKa1, EC 2.7.11, EC 2.7.11.1, MGC33776, MGC57364, protein kinase, AMP-activated, alpha 1 catalytic subunit | |
| PRKAA1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5562 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title