AMPK alpha 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156322

Catalog No. NBP156322

Description

AMPK alpha 2 Polyclonal specifically detects AMPK alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot.

Specifications

• Antigen: AMPK alpha 2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 62 kDa
• Quantity: 100 μL
• Research Discipline: Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Translation Control
• Gene ID (Entrez): 5563
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: P54646
• Gene Symbols: PRKAA2
• Immunogen: Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: alpha-2.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG