Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AMPK alpha 2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15632220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15632220 20 μL
NBP156322 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15632220 Supplier Novus Biologicals Supplier No. NBP15632220UL

Rabbit Polyclonal Antibody

AMPK alpha 2 Polyclonal specifically detects AMPK alpha 2 in Human, Mouse, Rat samples. It is validated for Western Blot.

Specifications

Antigen AMPK alpha 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P54646
Gene Alias 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit
Gene Symbols PRKAA2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human PRKAA2 (NP_006243). Peptide sequence: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP.
Molecular Weight of Antigen 62 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Translation Control
Primary or Secondary Primary
Gene ID (Entrez) 5563
Test Specificity This product is specific to Subunit or Isoform: alpha-2.
Target Species Human, Mouse, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.