AMPK alpha 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23853225UL

Catalog No. NB404657

Description

AMPK alpha 2 Polyclonal specifically detects AMPK alpha 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AMPK alpha 2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P54646
• Gene Symbols: PRKAA2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Hypoxia, MAP Kinase Signaling, mTOR Pathway, Protein Kinase, Signal Transduction, Translation Control
• Gene ID (Entrez): 5563
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 5'-AMP-activated protein kinase catalytic subunit alpha-2, AMPK subunit alpha-2, AMPK2, AMPK5'-AMP-activated protein kinase, catalytic alpha-2 chain, AMPK-alpha-2 chain, EC 2.7.11, EC 2.7.11.1, PRKAA, protein kinase, AMP-activated, alpha 2 catalytic subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.