AMSH-LP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB430899	Novus Biologicals NBP18913525UL	25 μL
NBP189135	Novus Biologicals NBP189135	0.1 mL

Description

AMSH-LP Polyclonal specifically detects AMSH-LP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: AMSH-LP
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: Q96FJ0
• Gene ID (Entrez): 57559
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Molecular Weight of Antigen: 50 kDa

• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA replication Transcription Translation and Splicing
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ALMalpha, AMSH-FP, AMSHLP, AMSH-LPassociated molecule with the SH3 domain of STAM (AMSH) - Family Protein, associated molecule with the SH3 domain of STAM (AMSH) like protein, bA399O19.2, EC 3.1.2.15, EC 3.4.19.-, FLJ31524, KIAA1373AMSH-like protease, STAM binding protein-like 1, STAM-binding protein-like 1
• Gene Symbols: STAMBPL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human AMSH-LP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only