Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Amylin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$494.86
Specifications
| Antigen | Amylin |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP169210
|
Novus Biologicals
NBP169210 |
100 μL |
Each for $494.86
|
|
|||||
|
NBP16921020
|
Novus Biologicals
NBP16921020UL |
20 μL | N/A | N/A | N/A | ||||
Description
Amylin Polyclonal specifically detects Amylin in Human samples. It is validated for Western Blot.Specifications
| Amylin | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Apoptosis, Cancer | |
| AMYLIN, DAPamylin, Diabetes-associated peptide, IAP, Insulinoma amyloid peptide, islet amyloid polypeptide, Islet amyloid polypeptide (diabetes-associated peptide; amylin) | |
| IAPP | |
| IgG | |
| 4 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P10997 | |
| 3375 | |
| Synthetic peptides corresponding to IAPP (islet amyloid polypeptide) The peptide sequence was selected from the N terminal of IAPP (NP_000406). Peptide sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title