Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANGEL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17958020UL
Description
ANGEL1 Polyclonal specifically detects ANGEL1 in Mouse samples. It is validated for Western Blot.Specifications
ANGEL1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_653107 | |
ANGEL1 | |
Synthetic peptide directed towards the C terminal of human Angel1The immunogen for this antibody is Angel1. Peptide sequence SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD. | |
Affinity Purified | |
RUO | |
23357 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
angel homolog 1 (Drosophila), FLJ60172, KIAA0759, protein angel homolog 1 | |
Rabbit | |
73 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction