Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANGEL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ANGEL1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17958020
![]() |
Novus Biologicals
NBP17958020UL |
20 μL |
Each for $206.00
|
|
|||||
NBP179580
![]() |
Novus Biologicals
NBP179580 |
100 μL |
Each for $487.50
|
|
|||||
Description
ANGEL1 Polyclonal specifically detects ANGEL1 in Mouse samples. It is validated for Western Blot.Specifications
ANGEL1 | |
Polyclonal | |
Rabbit | |
NP_653107 | |
23357 | |
Synthetic peptide directed towards the C terminal of human Angel1The immunogen for this antibody is Angel1. Peptide sequence SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
angel homolog 1 (Drosophila), FLJ60172, KIAA0759, protein angel homolog 1 | |
ANGEL1 | |
IgG | |
73 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title