Angiopoietin-like Protein 5/ANGPTL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157966

Catalog No. NBP157966

Description

Angiopoietin-like Protein 5/ANGPTL5 Polyclonal specifically detects Angiopoietin-like Protein 5/ANGPTL5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Angiopoietin-like Protein 5/ANGPTL5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: angiopoietin-like 5, Angiopoietin-like protein 5, angiopoietin-related protein 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 253935
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86XS5
• Gene Symbols: ANGPTL5
• Immunogen: Synthetic peptides corresponding to ANGPTL5(angiopoietin-like 5) The peptide sequence was selected from the N terminal of ANGPTL5. Peptide sequence ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Bovine: 92%; Pig: 92%; Canine: 85%; Guinea pig: 85%.
• Target Species: Human, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG