Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Angiopoietin-like Protein 5/ANGPTL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Angiopoietin-like Protein 5/ANGPTL5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Angiopoietin-like Protein 5/ANGPTL5 Polyclonal specifically detects Angiopoietin-like Protein 5/ANGPTL5 in Human samples. It is validated for Western Blot.Specifications
Angiopoietin-like Protein 5/ANGPTL5 | |
Polyclonal | |
Rabbit | |
Q86XS5 | |
253935 | |
Synthetic peptides corresponding to ANGPTL5(angiopoietin-like 5) The peptide sequence was selected from the N terminal of ANGPTL5. Peptide sequence ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
angiopoietin-like 5, Angiopoietin-like protein 5, angiopoietin-related protein 5 | |
ANGPTL5 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title