Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Angiopoietin-like Protein 6/ANGPTL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310663100UL
Description
Angiopoietin-like Protein 6/ANGPTL6 Polyclonal specifically detects Angiopoietin-like Protein 6/ANGPTL6 in Human samples. It is validated for Western Blot.Specifications
Angiopoietin-like Protein 6/ANGPTL6 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
AGFAngiopoietin-related protein 5, angiopoietin-like 6, Angiopoietin-like protein 6, Angiopoietin-related growth factor, ARP5angiopoietin-related protein 6 | |
The immunogen for Anti-Angiopoietin-like Protein 6/ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6 (NP_114123.2). Peptide sequence PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
83854 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction