Angiopoietin-like Protein 6/ANGPTL6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310663100UL

Catalog No. NB126227

Description

Angiopoietin-like Protein 6/ANGPTL6 Polyclonal specifically detects Angiopoietin-like Protein 6/ANGPTL6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Angiopoietin-like Protein 6/ANGPTL6
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AGFAngiopoietin-related protein 5, angiopoietin-like 6, Angiopoietin-like protein 6, Angiopoietin-related growth factor, ARP5angiopoietin-related protein 6
• Immunogen: The immunogen for Anti-Angiopoietin-like Protein 6/ANGPTL6 antibody is: synthetic peptide directed towards the C-terminal region of Human ANGL6 (NP_114123.2). Peptide sequence PESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGG
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83854
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.