ANKRD22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18116725UL

Catalog No. NB433927

Description

ANKRD22 Polyclonal specifically detects ANKRD22 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ANKRD22
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Accession No.: Q5VYY1
• Gene Symbols: ANKRD22
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KTKQNEALVRMLLDAGVEVNATDCYGCTALHYACEMKNPSLIPLLLEARADPTIKNKHGESSLDIARRLKFSQIELMLRK
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 118932
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: ankyrin repeat domain 22, ankyrin repeat domain-containing protein 22, MGC22805
• Host Species: Rabbit
• Molecular Weight of Antigen: 22 kDa
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only