Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ANKRD37 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15534720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15534720 20 μL
NBP155347 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15534720 Supplier Novus Biologicals Supplier No. NBP15534720UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ANKRD37 Polyclonal specifically detects ANKRD37 in Human samples. It is validated for Western Blot.

Specifications

Antigen ANKRD37
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7Z713
Gene Alias ankyrin repeat domain 37, ankyrin repeat domain-containing protein 37, hLrp2bp, low density lipoprotein receptor-related protein binding protein, Low-density lipoprotein receptor-related protein 2-binding protein, LPR2BP, Lrp2bp, MGC111507
Gene Symbols ANKRD37
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ANKRD37(ankyrin repeat domain 37) The peptide sequence was selected from the middle region of ANKRD37. Peptide sequence GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK.
Molecular Weight of Antigen 17 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 353322
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.