Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ANKRD54 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ANKRD54 Polyclonal specifically detects ANKRD54 in Human samples. It is validated for Western Blot.Specifications
ANKRD54 | |
Polyclonal | |
Rabbit | |
Q6NXT1 | |
129138 | |
Synthetic peptides corresponding to ANKRD54 (ankyrin repeat domain 54) The peptide sequence was selected from the middle region of ANKRD54 (NP_620152). Peptide sequence EVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGND. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ankyrin repeat domain 54, LIARankyrin repeat domain-containing protein 54 | |
ANKRD54 | |
IgG | |
33 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title