ANKRD7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157699

Catalog No. NBP157699

Description

ANKRD7 Polyclonal specifically detects ANKRD7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ANKRD7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ankyrin repeat domain 7, ankyrin repeat domain-containing protein 7, testis-specific ankyrin motif containing protein, Testis-specific protein TSA806, TSA806
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56311
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92527
• Gene Symbols: ANKRD7
• Immunogen: Synthetic peptides corresponding to ANKRD7(ankyrin repeat domain 7) The peptide sequence was selected from the middle region of ANKRD7. Peptide sequence EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Rabbit: 90%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Rabbit
• Isotype: IgG