Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKRD7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ANKRD7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ANKRD7 Polyclonal specifically detects ANKRD7 in Human samples. It is validated for Western Blot.Specifications
ANKRD7 | |
Polyclonal | |
Rabbit | |
Q92527 | |
56311 | |
Synthetic peptides corresponding to ANKRD7(ankyrin repeat domain 7) The peptide sequence was selected from the middle region of ANKRD7. Peptide sequence EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ankyrin repeat domain 7, ankyrin repeat domain-containing protein 7, testis-specific ankyrin motif containing protein, Testis-specific protein TSA806, TSA806 | |
ANKRD7 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title