ANKS1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310686100UL

Catalog No. NB126273

Description

ANKS1B Polyclonal specifically detects ANKS1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ANKS1B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: AIDA-1AIDA, amyloid-beta precursor protein intracellular domain associated protein 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, ankyrin repeat and sterile alpha motif domain containing 1B, ankyrin repeat and sterile alpha motif domain-containing protein 1B, cajalin 2, cajalin-2, E2A-PBX1-associated protein, EB1, EB-1MGC26087
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKS1B (NP_001190995). Peptide sequence ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56899
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.