Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ANKS1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ANKS1B |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ANKS1B Polyclonal specifically detects ANKS1B in Human samples. It is validated for Western Blot.Specifications
| ANKS1B | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| AIDA-1AIDA, amyloid-beta precursor protein intracellular domain associated protein 1, Amyloid-beta protein intracellular domain-associated protein 1, ANKS2, ankyrin repeat and sterile alpha motif domain containing 1B, ankyrin repeat and sterile alpha motif domain-containing protein 1B, cajalin 2, cajalin-2, E2A-PBX1-associated protein, EB1, EB-1MGC26087 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKS1B (NP_001190995). Peptide sequence ACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 56899 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title