Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Annexin A7 Antibody, Novus Biologicals™

Annexin A7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159099 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159099 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159099 Supplier Novus Biologicals Supplier No. NBP159099
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Annexin A7 Polyclonal specifically detects Annexin A7 in Human samples. It is validated for Western Blot.

Specifications

Antigen Annexin A7
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q5T0M6
Gene Alias annexin A7, ANX7, ANXA7, SNX, SYNEXIN
Gene Symbols ANXA7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ANXA7 (annexin A7) The peptide sequence was selected from the N terminal of ANXA7 (NP_001147). Peptide sequence MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 310
Reconstitution Centrifuge vial prior to reconstitution. Add 100μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.