Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001305

akirin 2, Mouse, Clone: 3D9, Abnova™

Catalog No. 89001305 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-305 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-305 Supplier Abnova Corporation Supplier No. H00055122M01
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant C6orf166.

Sequence: MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS

Specifications

Antigen akirin 2
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 3D9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant C6orf166.
Formulation PBS with no preservative; pH 7.4
Gene AKIRIN2
Gene Accession No. BC000764
Gene Alias C6orf166/FBI1/FLJ10342/dJ486L4.2
Gene Symbols AKIRIN2
Host Species Mouse
Immunogen C6orf166 (AAH00764, 1 a.a. ∼ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 55122
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.