akirin 2, Mouse, Clone: 3D9, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant C6orf166.

Supplier:  Abnova Corporation H00055122M01

Catalog No. 89-001-305

Description

Sequence: MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS

Specifications

• Antigen: akirin 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC000764
• Gene Symbols: AKIRIN2
• Immunogen: C6orf166 (AAH00764, 1 a.a. ∼ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 55122
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 3D9
• Description: Mouse monoclonal antibody raised against a full length recombinant C6orf166.
• Gene: AKIRIN2
• Gene Alias: C6orf166/FBI1/FLJ10342/dJ486L4.2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody