caspase 10, apoptosis-related cysteine peptidase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-046	50 μL

Catalog No. 89-004-046 Supplier Abnova Corporation Supplier No. H00000843A01

Description

Mouse polyclonal antibody raised against a partial recombinant CASP10.

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 3 and 7, and the protein itself is processed by caspase 8. Mutations in this gene are associated with apoptosis defects seen in type II autoimmune lymphoproliferative syndrome. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq

Sequence: MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQ

Specifications

• Antigen: caspase 10, apoptosis-related cysteine peptidase
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CASP10.
• Formulation: 50% glycerol
• Gene: CASP10
• Gene Accession No.: NM_032974
• Gene Alias: ALPS2/FLICE2/MCH4
• Gene Symbols: CASP10
• Host Species: Mouse
• Immunogen: CASP10 (NP_116756, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 843
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum