CC2D1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152841

Catalog No. NBP152841

Description

CC2D1B Polyclonal specifically detects CC2D1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CC2D1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: coiled-coil and C2 domain containing 1B, KIAA1836coiled-coil and C2 domain-containing protein 1B
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5T0F9
• Gene Symbols: CC2D1B
• Immunogen: Synthetic peptides corresponding to CC2D1B(coiled-coil and C2 domain containing 1B) The peptide sequence was selected from the C terminal of CC2D1B. Peptide sequence IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200014
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG