Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-CD2F-10/SLAMF9, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP184593 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP184593 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP184593 Supplier Novus Biologicals Supplier No. NBP184593

Rabbit Polyclonal Antibody

CD2F-10/SLAMF9 Polyclonal specifically detects CD2F-10/SLAMF9 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CD2F-10/SLAMF9
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias CD2 family member 10, CD2F10, CD2F-10MGC88194, CD84 homolog 1, CD84H1, CD84-H1cluster of differentiation 2 antigen family member 10, cluster of differentiation 84 homolog 1, SF2001, signaling lymphocytic activation molecule family member 2001, signaling lymphocytic activation molecule family member 9, SLAM family member 9
Gene Symbols SLAMF9
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 89886
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.