Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

anti-Connexin 62/GJA10, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP214050

Catalog No. NBP214050


Add to cart

Description

Description

Connexin 62/GJA10 Polyclonal specifically detects Connexin 62/GJA10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Connexin 62/GJA10
Unconjugated
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
connexin 62, connexin-62, Cx62, CX62gap junction alpha-10 protein, gap junction protein, alpha 10, 62kDa, RP11-63K6.6
Rabbit
IgG
0.1 ml
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunohistochemistry, Immunohistochemistry (Paraffin)
Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Affinity Purified
GJA10
This antibody was developed against Recombinant Protein corresponding to amino acids: SEGIEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVP KSKTMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQ HLGQQSDHSSFGLQNTMSQSWLGT
Immunogen affinity purified
RUO
Primary
84694
Human
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only