Learn More
Description
Specifications
Specifications
| Antigen | ERCC6L |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | ATP-dependent helicase ERCC6-like, DNA excision repair protein ERCC-6-like, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 6-like, excision repair protein ERCC6-like, FLJ20105, MGC131695, PICHexcision repair cross-complementing rodent repair deficiency complementationgroup 6 - like, PLK1-interacting checkpoint helicase, SNF2/RAD54 family protein, Tumor antigen BJ-HCC-15 |
| Gene Symbols | ERCC6L |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: IIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSARACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTLMEESGKMIFLMDLL |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
