glycoprotein (transmembrane) nmb, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant GPNMB.

Supplier:  Abnova Corporation H00010457A01

Catalog No. 89-015-820

Description

The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTL

Specifications

• Antigen: glycoprotein (transmembrane) nmb
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant GPNMB.
• Gene: GPNMB
• Gene Alias: HGFIN/NMB
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Cycle
• Gene ID (Entrez): 10457
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_001005340
• Gene Symbols: GPNMB
• Immunogen: GPNMB (NP_001005340, 104 a.a. ∼ 203 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum