glycogen synthase kinase 3 beta, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-145	50 μL

Catalog No. 89-004-145

Supplier: Abnova Corporation H00002932A01

Description

Mouse polyclonal antibody raised against a partial recombinant GSK3B.

The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene

Sequence: MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQI

Specifications

• Antigen: glycogen synthase kinase 3 beta
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant GSK3B.
• Formulation: 50% glycerol
• Gene: GSK3B
• Gene Accession No.: NM_002093
• Gene Symbols: GSK3B
• Host Species: Mouse
• Immunogen: GSK3B (NP_002084, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 2932
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum